| Desktop | 84/100 | ✔ |
| Mobile | 63/100 | ❗ |
| Field | Data | Result |
|---|---|---|
| Page Size | 87 KB | ✔ |
| Compression | 0 KB (-26.7%) | ✔ |
| Text/Html Ratio | 2364 / 88960 (bytes) = 2.66% | ❗ |
| Load Time | 2.2 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 8 | ✔ |
| Doc Type | ✔ | |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 1 / 1 | ❗ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| carpet | 11 | ✔ | ✔ | ✔ |
| cleaning | 8 | ✔ | ✔ | ✔ |
| contact | 3 | ✘ | ✘ | ✔ |
| pearsons | 3 | ✔ | ✔ | ✔ |
| more | 2 | ✘ | ✔ | ✘ |
| rugs | 2 | ✘ | ✘ | ✘ |
| other | 2 | ✘ | ✘ | ✘ |
| business | 2 | ✘ | ✘ | ✔ |
| images | 2 | ✘ | ✘ | ✘ |
| keep | 2 | ✘ | ✘ | ✔ |
| provided | 2 | ✘ | ✘ | ✘ |
| company | 2 | ✘ | ✘ | ✘ |
| home | 2 | ✘ | ✘ | ✘ |
| carpets | 2 | ✘ | ✘ | ✔ |
| upholstery | 2 | ✘ | ✔ | ✘ |
|
With 2.2 seconds in page load, 87 KB of page size and all other reports below, the carpetcleaningservicewichitaks.com has a SEO score of 66 out of 100 |
| Title | Carpet Cleaners in Wichita, KS | Pearsons Carpet Cleaning |
| Description | Pearsons Carpet Cleaning offers Carpet Cleaning Services in Wichita, Kansas and surrounding areas. We specialize in Commercial Carpet Cleaning, Residential Carpet Cleaning, Upholstery Cleaning, Water Damage Clean Up, and more! |
| Keyword |
| Age | 0 Years, 4 Days |
| Created | 21st-Jul-2020 |
| Updated | 21st-Jul-2020 |
| Expiry | 21st-Jul-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| carpetcleaningservicewichitaks.com | A | 14378 | ip:35.172.94.1 |
| carpetcleaningservicewichitaks.com | A | 14378 | ip:100.24.208.97 |
| carpetcleaningservicewichitaks.com | NS | 3600 | target:ns36.domaincontrol.com |
| carpetcleaningservicewichitaks.com | NS | 3600 | target:ns35.domaincontrol.com |
| carpetcleaningservicewichitaks.com | SOA | 3600 | mname:ns35.domaincontrol.comrname:dns.jomax.netserial:2020072200refresh:28800retry:7200expire:604800minimum-ttl:600 |
| carpetcleaningservicewichitaks.com | TXT | 3600 | txt:google-site-verification=KfhzKDM1oEhNFSrcAxO07JgbzZZb-RNboMGJWmyiE0c |
|
Domain Name: carpetcleaningservicewichitaks.com Registry Domain ID: 2547568685_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-07-21T15:36:26Z Creation Date: 2020-07-21T15:36:25Z Registrar Registration Expiration Date: 2021-07-21T15:36:25Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registrant Organization: Registrant State/Province: Arizona Registrant Country: US Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=carpetcleaningservicewichitaks.com Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=carpetcleaningservicewichitaks.com Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=carpetcleaningservicewichitaks.com Name Server: NS35.DOMAINCONTROL.COM Name Server: NS36.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-07-25T12:00:00Z |
| Server IP | 100.24.208.97 |
| Server Location | United States |
| Service Provider | Amazon.com |
| Domains (TLD) | Status |
|---|---|
| carpetcleaningservicewichitaks.net | Available |
| carpetcleaningservicewichitaks.org | Available |
| carpetcleaningservicewichitaks.biz | Already Registered |
| carpetcleaningservicewichitaks.io | Already Registered |
| carpetcleaningservicewichitaks.info | Available |
| Domains (TLD) | Status |
|---|---|
| xarpetcleaningservicewichitaks.com | Available |
| sarpetcleaningservicewichitaks.com | Available |
| darpetcleaningservicewichitaks.com | Available |
| farpetcleaningservicewichitaks.com | Available |
| varpetcleaningservicewichitaks.com | Available |
| Hunydewskin.com |
| Villa-shayanne.com |
| Buenmensaje.com |
| Creamridgetransmission.net |
| Claimpaymentprocessing.com |
| Samesbronco.net |
| Polarr-tool.com |
| Maxborgesagencymiami.com |
| Osweeten.com |
| Fitfleece.com |